PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.6NG030900.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family HD-ZIP
Protein Properties Length: 795aa    MW: 85342.2 Da    PI: 5.9281
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.6NG030900.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox61.21.6e-19120175156
                          TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
             Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                          +++ +++t++q++eLe++F++ ++p+ ++r+eL+++lgL+  qVk+WFqN+R+++k
  Pavir.6NG030900.1.p 120 KKRYHRHTQHQIQELEAFFKEFPHPDDKQRKELSRELGLEPLQVKFWFQNKRTQMK 175
                          688999***********************************************999 PP

2START206.41.1e-643095331206
                          HHHHHHHHHHHHHHHHC-TT-EEEE......EXCCTTEEEEEEESSS......SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S.. CS
                START   1 elaeeaaqelvkkalaeepgWvkss......esengdevlqkfeeskv.....dsgealrasgvvdmvlallveellddkeqWdetla.. 77 
                          ela +a++elv++a+++ep+Wv         e +n++e+ + f+++ +      ++ea+r+++vv+m++++lve l+d++ qW++ +   
  Pavir.6NG030900.1.p 309 ELAVAAMEELVRMAQLGEPLWVPALvdgaapETLNEEEYARGFPRGVGpkspeLRSEASRETVVVIMNHVNLVEMLMDVN-QWSTLFSsi 397
                          57899*****************99999****************99777********************************.******999 PP

                          ..EEEEEEEECTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.-TTSEE-EESSEEEEEEEEC CS
                START  78 ..kaetlevissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgiliepks 158
                            +a+tlev+s+g      galqlm+ae+q++splvp R++ fvRy++q+++g+w++vdvS+d  +     + ++R++++pSg+li++++
  Pavir.6NG030900.1.p 398 vsRAATLEVLSTGvagnynGALQLMTAEFQMPSPLVPtRESQFVRYCKQHPDGGWAVVDVSLDGLRAG--GAAGARGQRRPSGCLIQEMP 485
                          99*****************************************************************8..58****************** PP

                          TCEEEEEEEE-EE--SSXXHHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
                START 159 nghskvtwvehvdlkgrlphwllrslvksglaegaktwvatlqrqcek 206
                          ng+s+vtwveh++ +++++h+l+r+lv+sgla+ga++w a+l+rqce+
  Pavir.6NG030900.1.p 486 NGYSRVTWVEHAEADDAMVHELYRPLVSSGLAFGARRWAAALERQCER 533
                          **********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.0E-21103161IPR009057Homeodomain-like
SuperFamilySSF466891.59E-19105178IPR009057Homeodomain-like
PROSITE profilePS5007117.248117177IPR001356Homeobox domain
SMARTSM003894.4E-19118181IPR001356Homeobox domain
CDDcd000864.94E-19119178No hitNo description
PfamPF000464.3E-17120175IPR001356Homeobox domain
PROSITE patternPS000270152175IPR017970Homeobox, conserved site
Gene3DG3DSA:1.10.10.601.9E-4162204IPR009057Homeodomain-like
PROSITE profilePS5084842.736300536IPR002913START domain
SuperFamilySSF559616.04E-32303535No hitNo description
CDDcd088751.49E-116304532No hitNo description
SMARTSM002341.9E-63309533IPR002913START domain
PfamPF018522.0E-53310533IPR002913START domain
Gene3DG3DSA:3.30.530.207.3E-5380526IPR023393START-like domain
SuperFamilySSF559612.16E-24558782No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 795 aa     Download sequence    Send to blast
MVGGEYSELY MPGGMMIPAG RNMPAAGRIG GLASYAASLG QNMMDGQHQL AVMQQHQQQH  60
QNHGQQQQAA TTGSDAHDPH HNELLMESKS GSDNMEGGIG SGSGGEELQE EDLSLQRPRK  120
KRYHRHTQHQ IQELEAFFKE FPHPDDKQRK ELSRELGLEP LQVKFWFQNK RTQMKTQQER  180
QENTQLRAEN EKLRAENARY KDALTNAACP NCGGPATAVI GEMSFDEHHL RIENMRLRDE  240
IDRISAIAAK YVGKPAASML PNSSNISSVA AQYPPPLSTH HLITGAGDMF GSLHHHGAAA  300
GFDKPLVIEL AVAAMEELVR MAQLGEPLWV PALVDGAAPE TLNEEEYARG FPRGVGPKSP  360
ELRSEASRET VVVIMNHVNL VEMLMDVNQW STLFSSIVSR AATLEVLSTG VAGNYNGALQ  420
LMTAEFQMPS PLVPTRESQF VRYCKQHPDG GWAVVDVSLD GLRAGGAAGA RGQRRPSGCL  480
IQEMPNGYSR VTWVEHAEAD DAMVHELYRP LVSSGLAFGA RRWAAALERQ CERLASAMAS  540
GVPAVPAAGD AGVVTSAEGR RSMLRLAERM VASFCGGVTA STTHQWTTLS GSGPEDVRVM  600
TRKSVDDPGR PPGIILNAAT SFWLPVPPAR VFSFLRDDAT RSEWDILSNG GDVQEMAHIA  660
NGRDQGNAVS LLRVNNANSN QSNMLILQEC CTDATGSYVI YAPVDVVAMN VVLNGGDPDY  720
VALLPSGFAI LPDGPGAGAT GGGSLLTVAF QILVDSVPTA KLSLGSVATV NSLIACTVER  780
IKAALAADTA GGGR*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pvr.173700.0stem
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004972909.10.0PREDICTED: homeobox-leucine zipper protein ROC7-like
SwissprotA3BPF20.0ROC7_ORYSJ; Homeobox-leucine zipper protein ROC7
TrEMBLK3YGB10.0K3YGB1_SETIT; Uncharacterized protein
STRINGSi013279m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP79938147
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G21750.20.0HD-ZIP family protein